- GBP6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84117
- Human
- GBP6
- This antibody was developed against Recombinant Protein corresponding to amino acids: EREHLLREQI MMLEHTQKVQ NDWLHEGFKK KYEEMNAEIS QFKRMIDTTK NDDTPWIART LDNLADELTA ILSAPAKLIG HGVKGV
- 0.1 ml (also 25ul)
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- guanylate binding protein family member 6
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Innate Immunity
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Specifications/Features
Available conjugates: Unconjugated